Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens angiogenin (ANG), transcript variant 1 (NM_001145). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P03950 |
| Entry Name | ANGI_HUMAN |
| Gene Names | ANG RNASE5 |
| Alternative Gene Names | RNASE5 |
| Alternative Protein Names | Angiogenin (EC 3.1.27.-) (Ribonuclease 5) (RNase 5) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 147 |
| Molecular Weight(Da) | 16550 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MVMGLGVLLLVFVLGLGLTPPTLAQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLPVHLDQSIFRRP |
Background
| Function | FUNCTION: Binds to actin on the surface of endothelial cells; once bound, angiogenin is endocytosed and translocated to the nucleus. Stimulates ribosomal RNA synthesis including that containing the initiation site sequences of 45S rRNA. Cleaves tRNA within anticodon loops to produce tRNA-derived stress-induced fragments (tiRNAs) which inhibit protein synthesis and triggers the assembly of stress granules (SGs). Angiogenin induces vascularization of normal and malignant tissues. Angiogenic activity is regulated by interaction with RNH1 in vivo. {ECO:0000269|PubMed:12051708, ECO:0000269|PubMed:1400510, ECO:0000269|PubMed:19354288, ECO:0000269|PubMed:21855800}. |
| Pathway | |
| Protein Families | Pancreatic ribonuclease family |
| Tissue Specificity | Expressed predominantly in the liver. Also detected in endothelial cells and spinal cord neurons. {ECO:0000269|PubMed:17886298, ECO:0000269|PubMed:2440105}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
